From: Functional immunopeptides: advancing prevention and therapeutic strategies against animal diseases
CPP Peptide | CPP Sequence | Conjugation | Target Cell/Pathogen | Outcome | Source |
---|---|---|---|---|---|
TAT (HIV-1) | GRKKRRQRRRYK | Peptide nucleic acids (PNA) = Anti-gyrase A subunit gene (ttgcattatatg) | Streptococcus suis (swine bacteria) | Bactericidal effect | (Zhu et al. 2024) |
NLS-A (PCV2) | MTYPRRRFRRRRHRPRS | - | PK15, HeLa, NIH3 T3 | Novel CPP peptides derived from PCV2 | (Yu et al. 2018) |
- CPP5 - TAT | - KLVPM - YGRKKRRQRRR | Cre recombinase protein | Porcine fetal fibroblasts (PFFs) | Translocation of Cre protein across the plasma membrane of PFFs (transgenic pig) | (Kang et al. 2018) |
Z12 (zebra protein) | KRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLK | ASFV protein p30, p54, and T-cell epitope | RAW264.7 cells | - Increase cellular uptake - Induce neutralizing antibodies and good immunogenicity | |
VG21 (vesicular stomatitis virus) | VTPHHVLVDEYTGEWVDSQFK | Gold nanoparticles (GNPs) | Vero Hep-2 Cos-7 HeLa | Enhance cell internalization and biodistribution of gold nanoparticles | (Tiwari et al. 2014) |
Penetratin (PEN) | RQIKIWFQNR RMKWKK | Porcine scFv (trans-bodies) against NSP1β-PRRSV | MARC-145 | Increase cell internalization efficiency | (Thueng-In et al. 2023) |
- CPP1 - CPP2 (BFDV) | - RRYRRRRRYFRKRR - RRRRYARPYYRRR | - | DF-1 cells | CPP1 and 2 derived from beak and feather disease (BFDV) increase entry efficiency | (Sitinjak et al. 2023) |
CD2v (ASFV) | KPCPPP | - | CHO (chinese hamster ovary) | Provide CHO cell internalization | (S. Yang et al. 2021) |
CVP1-N2 (chicken anemia virus) | LKRLRRRYKFRHRRRQRYRRR | Apoptin gene | HCT116 | Intracellular delivery vehicle | (Hu et al. 2020) |
HA314 - 46 (HA protein of H5 N1 HPAIV) | TIGECPKYVKSNRLVLATGLRNSPQRERRRKKR | - | KU812 COS-7 | Increase cell internalization | (Kajiwara et al. 2020) |
AAV.CPP.16 (adeno-associated virus from macaques) | TVSALK | - | - HEK293T - Blood‒brain barrier | Provide blood‒brain barrier penetration in nonhuman primates | (Yao et al. 2022) |